Protein G Recombinant - 10mg

misc
miscmisc
Catalog #: PRO-402Description:Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C ...Read more
Catalog # PRO-402 $225.00 each


99 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: PRO-402

Description:
Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384 having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa.

Amino Acid Sequence:
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.

Applications:
Protein G binds to the constant region of many species of immunoglobulin G. It can be used to detect, quantify and purify IgG antibodies and antibody/antigen complexes. Recombinant Protein G contains only IgG binding domains. The albumin-binding domain as well as cell wall and cell membrane binding domains have been removed to ensure the maximum specific IgG binding capacity.

Purity:
>95% as determined by SDS-PAGE and RP-HPLC.

Formulation:
Lyophilized white Powder containing no additives.

Specificity:
1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a.
2. Does not bind to human IgM, IgD and IgA.

Reconstitution:
Reconstitution with deionized water or PBS.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Storage:
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution Protein G should be stored at 4 °C between 2-7 days and for future use below -18 °C.
Please prevent freeze-thaw cycles.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 435 researchers online

Your Purchases

The cart is empty