- Description
- Specifications
Catalog #: CYT-394
Description:
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
The IL-1b is purified by proprietary chromatographic techniques.
Synonyms:
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source:
Escherichia Coli.
Amino Acid Sequence:
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK
KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD
IVDFTMEPVSS.
Purity:
Greater than 97.0% as determined by SDS-PAGE.
Solubility:
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Formulation:
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Stability:
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution IL1b should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Activity:
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Protein Content:
Protein quantitation was carried out by two independent methods:
1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
