Interleukin-17F Mouse Recombinant - 25µg

cytokine
cytokinecytokine
Catalog #: CYT-642Description:IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.The Mouse IL-17F is purified by proprietary chromatographic techniques.Synonyms:Cytokine ML-1, I ...Read more
Catalog # CYT-642 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-642

Description:
IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.
The Mouse IL-17F is purified by proprietary chromatographic techniques.

Synonyms:
Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.

Source:
Escherichia Coli.

Amino Acid Sequence:
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP
WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR
EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.

Purity:
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.

Stability:
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution IL17F should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 253 researchers online

Your Purchases

The cart is empty