- Description
- Specifications
Catalog #: CYT-369
Description:
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
Synonyms:
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Amino Acid Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.
Purity:
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility:
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Formulation:
The protein was lyophilized without additives.
Stability:
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
