B-type Natriuretic Peptide Human Recombinant - 10µg

cytokine
cytokinecytokine
Catalog #: CYT-327Description:B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.NPPB is purified by proprietary chromatographic techniques.Synonyms:NPPB, Natriuretic Pe ...Read more
Catalog # CYT-327 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-327

Description:
B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
NPPB is purified by proprietary chromatographic techniques.

Synonyms:
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.

Source:
Escherichia Coli.

Amino Acid Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Purity:
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.

Stability:
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution NPPB should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 230 researchers online

Your Purchases

The cart is empty