Bone Morphogenetic Protein-7 Human Recombinant, Plant - 10µg

cytokine
Catalog #: CYT-039Description:Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.The BMP-7 is purified by proprietary chromatogr ...Read more
Catalog # CYT-039 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-039

Description:
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.

Synonyms:
Osteogenic Protein 1, BMP-7.

Source:
Nicotiana benthamiana.

Amino Acid Sequence:
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY
YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP
CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Purity:
Greater than 97.0% as determined by SDS-PAGE.

Solubility:
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/ µl.

Formulation:
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Stability:
Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution BMP 7 Human should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 2880 researchers online

Your Purchases

The cart is empty