Dengue Virus Subtype 1 Envelope 15kDa, C-Terminal (Domain III) Recombinant - 500µg

inf dis
inf disinf dis
Catalog #: DEN-011Description:The E.coli derived recombinant 12kDa protein is genetically engineered peptide which is derived from Dengue Type-1 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from ...Read more
Catalog # DEN-011 $975.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: DEN-011

Description:
The E.coli derived recombinant 12kDa protein is genetically engineered peptide which is derived from Dengue Type-1 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400, and is fused with a 6 His Tag. This peptide is particularly important for diagnostic and vaccine development as it contains multiple serotypes, neutralizing epitopes and receptor binding domain.

Amino Acid Sequence:
VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQN
GRLITANPIVTDKEKPVNIEAEPP FGESYIVVGAGEKALKLSWFKKGSV.

Applications:
Each laboratory should determine an optimum working titer for use in its particular application.

Method:
Purified by proprietary chromatographic technique.

Purity:
Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Formulation:
1x PBS pH 7.4.

Storage:
Dengue Envelope-ST1 D-III although stable at 4 °C for 1 week, should be stored below -18 °C.
Please prevent freeze thaw cycles.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 187 researchers online

Your Purchases

The cart is empty