Hepatitis B Surface Antigen, preS1 Recombinant - 50µg

inf dis
inf disinf dis
Catalog #: HBS-871Description:The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.Amino Acid Sequence:MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTP ...Read more
Catalog # HBS-871 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: HBS-871

Description:
The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa.

Amino Acid Sequence:
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGAN
SNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSP
QAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.

Applications:
1. Immunochromatography (capture and conjugate).
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1.
3. ELISA.

Purification Method:
HBsAg protein was purified by proprietary chromatographic technique.

Purity:
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Solubility:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

We have 2930 researchers online

Your Purchases

The cart is empty