Interleukin-8 Rabbit Recombinant (CXCL8) - 25µg

chemokine
Catalog #: CHM-261Description:IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.Synonyms:IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cel ...Read more
Catalog # CHM-261 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CHM-261

Description:
IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.

Synonyms:
IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP.

Source:
Escherichia Coli.

Amino Acid Sequence:
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV
QIFLKRAEQQES

Purity:
Greater than 90% as determined by SDS-PAGE.

Formulation:
The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.

Stability:
IL-8 although stable 4 °C for 4 weeks, should be stored desiccated below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered colorless solution.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 841 researchers online

Your Purchases

The cart is empty