Macrophage Migration Inhibitory Factor Human Recombinant (Active) - 10µg

growth factor
growth factorgrowth factor
Catalog #: CYT-596Description:MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 ...Read more
Catalog # CYT-596 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-596

Description:
MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.

Synonyms:
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Source:
Escherichia Coli.

Amino Acid Sequence:
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM
AFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVY
INYYDMNAANVGWNNSTFA.

Purity:
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ–cm H2O at a concentration between 0.1mg-1mg per 1ml.

Formulation:
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Stability:
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution MIF-protein should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 570 researchers online

Your Purchases

The cart is empty