Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus - 25µg

growth factor
growth factorgrowth factor
Catalog #: CYT-521Description:MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated ...Read more
Catalog # CYT-521 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-521

Description:
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.

Synonyms:
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Source:
Escherichia Coli.

Amino Acid Sequence:
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGS
SEPALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVG
WNNSTFALEHHHHHH.

Purity:
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.

Stability:
Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution MIF should be stored at 4 °C between 2-7 days and for future use below
-18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
Measured by its ability to bind rhCD74 in a functional ELISA.

Physical Appearance:
Sterile Filtered lyophilized powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 1815 researchers online

Your Purchases

The cart is empty