Myelin Oligodendrocyte Glycoprotein Human Recombinant - 50µg

misc
miscmisc
Catalog #: PRO-466Description:Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.Synonyms:Myelin Oligodendrocyte Glyc ...Read more
Catalog # PRO-466 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: PRO-466

Description:
Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Synonyms:
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.

Source:
Escherichia Coli.

Amino Acid Sequence:
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN
GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE
EAAMELKVEDPFYWVSPGHHHHHH.

Applications:
5-20 µg per ml for In-Vitro Experiments and 50-100 µg per animal for In-Vivo study.
The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, western blotting, ELISA and EAE induction in mice.

Purity:
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Stability:
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution MOG should be stored at 4 °C between 2-7 days and for future use below
-18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 244 researchers online

Your Purchases

The cart is empty