Noggin Human Recombinant - 20µg

growth factor
growth factorgrowth factor
Catalog #: CYT-475Description:Noggin Human Recombinant produced in E.Coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa).Noggin is purified by proprietary chromat ...Read more
Catalog # CYT-475 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-475

Description:
Noggin Human Recombinant produced in E.Coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa).
Noggin is purified by proprietary chromatographic techniques.

Synonyms:
SYM1, SYNS1, NOG.

Source:
Escherichia Coli.

Amino Acid Sequence:
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGH
YDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPS
EIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDL
GSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQR
RGQRCGWIPIQYPIISECKCSC.

Purity:
Greater than 95.0% as determined by SDS-PAGE.

Solubility:
It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.

Formulation:
Lyophilized from a 0.2µm filtered solution in 30% CH3CN, 0.1% TFA.

Stability:
Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution Noggin should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 µg/ml of Noggin, corresponding to a Specific Activity of 12,500-20,000units/mg

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Protein Content:
Protein quantitation was carried out by two independent methods:
1. UV spectroscopy at 280 nm using the absorbency value of 1.76 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of Noggin as a Reference Standard.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 182 researchers online

Your Purchases

The cart is empty