Oncostatin M Human Recombinant (209 a.a.) - 10µg

growth factor
growth factorgrowth factor
Catalog #: CYT-639Description:Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.Synonyms:OSM, ...Read more
Catalog # CYT-639 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-639

Description:
Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.
The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.

Synonyms:
OSM, MGC20461, Oncostatin M.

Source:
Escherichia Coli.

Amino Acid Sequence:
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG
AFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDL
EKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQ
RKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.

Purity:
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.

Stability:
Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 447 researchers online

Your Purchases

The cart is empty