Retinoblastoma Associated Protein Human Recombinant - 50µg

misc
miscmisc
Catalog #: PRO-584Description:Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa.The Retinoblastoma is purified by proprietary chromatographic techniques.Synonym ...Read more
Catalog # PRO-584 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: PRO-584

Description:
Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa.
The Retinoblastoma is purified by proprietary chromatographic techniques.

Synonyms:
RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED,PP110, Retinoblastoma-associated protein.

Source:
Escherichia Coli.

Amino Acid Sequence:
MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSK
HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH.

Purity:
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4.

Stability:
Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution Retinoblastoma should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 1571 researchers online

Your Purchases

The cart is empty