Syndecan-4 Human Recombinant, His Tag - 50µg

misc
miscmisc
Catalog #: PRO-583Description:Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa.The SDC4 is purified by proprietary chromatographic techniques.Synonyms:SDC4, SYND4, ...Read more
Catalog # PRO-583 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: PRO-583

Description:
Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa.

The SDC4 is purified by proprietary chromatographic techniques.

Synonyms:
SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4.

Source:
Escherichia Coli.

Amino Acid Sequence:
MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGD
LDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPK
RISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH.

Purity:
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized SDC4 in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.

Stability:
Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution SDC4 should be stored at 4 °C between 2-7 days and for future use below -18 °C.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 3226 researchers online

Your Purchases

The cart is empty