Transforming Growth Factor Beta 2 Human Recombinant - 5µg

growth factor
growth factorgrowth factor
Catalog #: CYT-441Description:TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.Synonyms:Tran ...Read more
Catalog # CYT-441 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-441

Description:
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Synonyms:
Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

Source:
Nicotiana benthamiana.

Amino Acid Sequence:
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH
EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS
PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.

Purity:
Greater than 97.0% as determined by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1 µg/40 µl, which can then be further diluted to other aqueous solutions.

Formulation:
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.

Stability:
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution TGFB2 Human should be stored at 4 °C between 2-7 days and for future use below -18 °C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Activity:
The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 1132 researchers online

Your Purchases

The cart is empty