Human Vascular Endothelial Growth Inhibitor Recombinant - 10µg

growth factor
growth factorgrowth factor
Catalog #: CYT-517Description:TNFSF15 Human Recombinant produced in E.Coli is a double, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 21.8 kDa.The TNFSF15 is purified by proprietary chromatographic techniques.Synonyms:Tumor necrosis factor ligand super ...Read more
Catalog # CYT-517 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-517

Description:
TNFSF15 Human Recombinant produced in E.Coli is a double, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 21.8 kDa.
The TNFSF15 is purified by proprietary chromatographic techniques.

Synonyms:
Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935.

Source:
Escherichia Coli.

Amino Acid Sequence:
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHL
TVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKF
LLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSIT
VVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAM
FSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.

Purity:
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The TNFSF15 was lyophilized from a concentrated (1 mg/ml) solution containing 0.5M NaCl and 50mM Tris-HCl pH-7.5.

Stability:
TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution VEGI should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The ED50 as determined by the dose-dependant inhibition of the proliferation of HUVEC (Human Umbilical Vein Endothelial Cells) is less than 5000ng/ml, corresponding to a Specific Activity of 200units/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 2499 researchers online

Your Purchases

The cart is empty